mariu.mihasan
The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted.
The model was re-orientated using the Auto-orientation plugin in Cura. Printed at 0.2 resolution with wall 4 lines. I have used concentric supports and found to be easier to remove.
Marius Mihășan, BioActive Research Group, Biochemistry and Molecular Biology Laboratory, Faculty of Biology Alexandru Ioan Cuza University of Iasi, Room B228, Carol I Blvd, no 20A, Iasi, Romania, 700506 Tel: +40(0)232202434, Fax: +40(0)232201472, e-mail: marius.mihasan@uaic.rohttps://mail.uaic.ro/~marius.mihasan/index.html